Recombinant Human C8G protein, His-SUMO-tagged
Cat.No. : | C8G-2613H |
Product Overview : | Recombinant Human C8G protein(P07360)(21-202aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-202aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.4 kDa |
AA Sequence : | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] |
Official Symbol | C8G |
Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; |
Gene ID | 733 |
mRNA Refseq | NM_000606 |
Protein Refseq | NP_000597 |
MIM | 120930 |
UniProt ID | P07360 |
◆ Recombinant Proteins | ||
C8G-4234H | Recombinant Human C8G protein, His-tagged | +Inquiry |
C8G-0583H | Recombinant Human C8G Protein (Lys39-Arg202), N-GST-tagged | +Inquiry |
C8G-2788H | Recombinant Human C8G Protein, His-tagged | +Inquiry |
C8G-11112Z | Recombinant Zebrafish C8G | +Inquiry |
C8G-2613H | Recombinant Human C8G protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8G-130HCL | Recombinant Human C8G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *
0
Inquiry Basket