Recombinant Human C8G Protein, His-tagged
| Cat.No. : | C8G-2788H |
| Product Overview : | Recombinant Human C8G Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Baculovirus |
| Species : | Human |
| Tag : | His |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 22.9 kDa |
| AA Sequence : | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Full Length : | Full L. |
| Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] |
| Official Symbol | C8G |
| Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; |
| Gene ID | 733 |
| mRNA Refseq | NM_000606 |
| Protein Refseq | NP_000597 |
| MIM | 120930 |
| UniProt ID | P07360 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *
0
Inquiry Basket
