Recombinant Human C8G Protein, His-tagged
Cat.No. : | C8G-2788H |
Product Overview : | Recombinant Human C8G Protein is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.9 kDa |
AA Sequence : | QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Full Length : | Full L. |
Gene Name | C8G complement component 8, gamma polypeptide [ Homo sapiens ] |
Official Symbol | C8G |
Synonyms | C8G; complement component 8, gamma polypeptide; complement component C8 gamma chain; C8C; MGC142186; |
Gene ID | 733 |
mRNA Refseq | NM_000606 |
Protein Refseq | NP_000597 |
MIM | 120930 |
UniProt ID | P07360 |
◆ Recombinant Proteins | ||
C8G-4234H | Recombinant Human C8G protein, His-tagged | +Inquiry |
C8G-2788H | Recombinant Human C8G Protein, His-tagged | +Inquiry |
C8G-0156H | Recombinant Human C8G Protein, His-Tagged | +Inquiry |
C8G-11112Z | Recombinant Zebrafish C8G | +Inquiry |
C8G-2043H | Recombinant Human C8G protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C8G-130HCL | Recombinant Human C8G lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C8G Products
Required fields are marked with *
My Review for All C8G Products
Required fields are marked with *
0
Inquiry Basket