Recombinant Human C5orf46 Protein, GST-Tagged

• Cat.No.: C5orf46-0096H
• Product Overview: Human C5orf46 full-length ORF (AAH21680.1, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: C5orf46 (Chromosome 5 Open Reading Frame 46) is a Protein Coding gene.
• Molecular Mass: 34.32 kDa
• AA Sequence: MAVLVLRLTVVLGLLVLFLTCYADDKPDKPDDKPDDSGKDPKPDFPKFLSLLGTEIIENAVEFILRSMSRST
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C5orf46 chromosome 5 open reading frame 46 [ Homo sapiens (human) ]
• Official Symbol: C5orf46
• Synonyms: C5orf46; chromosome 5 open reading frame 46; uncharacterized protein C5orf46; CTC-327F10.5; skin and saliva secreted protein 1
• Gene ID: 389336
• mRNA Refseq: NM_206966
• Protein Refseq: NP_996849
• UniProt ID: Q6UWT4