Recombinant Human GOLM1 protein, His-tagged

• Cat.No.: GOLM1-2979H
• Product Overview: Recombinant Human GOLM1 protein(Q8NBJ4)(36-401aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 36-401aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.6 kDa
• AA Sequence: SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GOLM1 golgi membrane protein 1 [ Homo sapiens ]
• Official Symbol: GOLM1
• Synonyms: GOLM1; golgi membrane protein 1; C9orf155, chromosome 9 open reading frame 155 , golgi phosphoprotein 2 , GOLPH2; Golgi membrane protein 1; bA379P1.3; FLJ23608; GP73; golgi protein, 73-kD; golgi phosphoprotein 2; golgi membrane protein GP73; GOLPH2; C9orf155; PSEC0257; FLJ22634
• Gene ID: 51280
• mRNA Refseq: NM_016548
• Protein Refseq: NP_057632
• MIM: 606804
• UniProt ID: Q8NBJ4