Recombinant Human C1QTNF9 protein, His-tagged
Cat.No. : | C1QTNF9-19H |
Product Overview : | Recombinant Human C1QTNF9(Gln20-Pro333) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-333 a.a. |
Description : | Complement C1q and tumor necrosis factor-related protein 9A is also known as C1QTNF9A, AQL1, CTRP9, C1q and tumor necrosis factor related protein 9. C1QTNF9 is a secreted protein and contains one C1q domain and three collagen-like domains. C1QTNF9 interacts with ADIPOQ via the C1q domain to form a heterotrimeric complex and also interacts with CTRP9B to forms heterotrimers and heterooligomeric complexes with CTRP9B. C1QTNF9 is expressed predominantly in adipose tissue. C1QTNF9 can activates AMPK, AKT, and p44/42 MAPK signaling pathways. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4 |
AA Sequence : | QDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEA KGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTG LPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKF PSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDA YMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSPVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ] |
Official Symbol | C1QTNF9 |
Synonyms | C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9; |
Gene ID | 338872 |
mRNA Refseq | NM_178540 |
Protein Refseq | NP_848635 |
MIM | 614285 |
UniProt ID | P0C862 |
Chromosome Location | 13q12.12 |
Function | hormone activity; |
◆ Recombinant Proteins | ||
C1qtnf9-2109M | Recombinant Mouse C1qtnf9, His-tagged | +Inquiry |
C1QTNF9-6426HF | Recombinant Full Length Human C1QTNF9 Protein, GST-tagged | +Inquiry |
C1QTNF9-0020H | Recombinant Human C1QTNF9 Protein (Gln20-Pro333), C-His-tagged | +Inquiry |
C1QTNF9-18H | Active Recombinant Human C1QTNF9 protein, His-tagged | +Inquiry |
C1QTNF9-238H | Recombinant Human C1QTNF9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1QTNF9-8134HCL | Recombinant Human C1QTNF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C1QTNF9 Products
Required fields are marked with *
My Review for All C1QTNF9 Products
Required fields are marked with *
0
Inquiry Basket