Recombinant Human C1QTNF9 Protein, GST-tagged

• Cat.No.: C1QTNF9-5291H
• Product Overview: Human MGC48915 full-length ORF ( AAH40438.1, 1 a.a. - 333 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: C1QTNF9 (C1q And TNF Related 9) is a Protein Coding gene. GO annotations related to this gene include hormone activity. An important paralog of this gene is C1QTNF9B.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61 kDa
• AA Sequence: MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDVPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: C1QTNF9 C1q and tumor necrosis factor related protein 9 [ Homo sapiens ]
• Official Symbol: C1QTNF9
• Synonyms: C1QTNF9; C1q and tumor necrosis factor related protein 9; complement C1q and tumor necrosis factor-related protein 9A; AQL1; C1QTNF9A; CTRP9; MGC48915; complement C1q tumor necrosis factor-related protein 9; complement C1q tumor necrosis factor-related protein 9A; complement C1q and tumor necrosis factor-related protein 9
• Gene ID: 338872
• mRNA Refseq: NM_178540
• Protein Refseq: NP_848635
• MIM: 614285
• UniProt ID: P0C862