Recombinant Human BST2
Cat.No. : | BST2-26110TH |
Product Overview : | Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. |
Protein length : | 141 amino acids |
Molecular Weight : | 41.250kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ |
Sequence Similarities : | Belongs to the tetherin family. |
Tag : | Non |
Gene Name | BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ] |
Official Symbol | BST2 |
Synonyms | BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin; |
Gene ID | 684 |
mRNA Refseq | NM_004335 |
Protein Refseq | NP_004326 |
MIM | 600534 |
Uniprot ID | Q10589 |
Chromosome Location | 19p13.2 |
Function | protein homodimerization activity; signal transducer activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BST2 Products
Required fields are marked with *
My Review for All BST2 Products
Required fields are marked with *
0
Inquiry Basket