Recombinant Human BST2

• Cat.No.: BST2-26110TH
• Product Overview: Recombinant fragment of Human BST2 with N terminal proprietary tag; Predicted MWt 41.25 kDa including the tag.

Specification

• Description: Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
• Protein length: 141 amino acids
• Molecular Weight: 41.250kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Predominantly expressed in liver, lung, heart and placenta. Lower levels in pancreas, kidney, skeletal muscle and brain. Overexpressed in multiple myeloma cells. Highly expressed during B-cell development, from pro-B precursors to plasma cells. Highly exp
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQK GFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGE ITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQD SSSAAAPQLLIVLLGLSALLQ
• Sequence Similarities: Belongs to the tetherin family.
• Tag: Non

Gene Information

• Gene Name: BST2 bone marrow stromal cell antigen 2 [ Homo sapiens ]
• Official Symbol: BST2
• Synonyms: BST2; bone marrow stromal cell antigen 2; bone marrow stromal antigen 2; CD317; tetherin
• Gene ID: 684
• mRNA Refseq: NM_004335
• Protein Refseq: NP_004326
• MIM: 600534
• Uniprot ID: Q10589
• Chromosome Location: 19p13.2
• Function: protein homodimerization activity; signal transducer activity