Recombinant Human BST1 Protein, C-His-tagged
Cat.No. : | BST1-135H |
Product Overview : | Recombinant Human BST1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | BST1, synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth. |
Molecular Mass : | ~29 kDa |
AA Sequence : | GARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKA |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ] |
Official Symbol | BST1 |
Synonyms | BST1; bone marrow stromal cell antigen 1; ADP-ribosyl cyclase 2; ADP ribosyl cyclase 2; CD157; NAD(+) nucleosidase; BST-1; cADPr hydrolase 2; bone marrow stromal antigen 1; cyclic ADP-ribose hydrolase 2; |
Gene ID | 683 |
mRNA Refseq | NM_004334 |
Protein Refseq | NP_004325 |
MIM | 600387 |
UniProt ID | Q10588 |
◆ Cell & Tissue Lysates | ||
BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *
0
Inquiry Basket