Recombinant Human BST1 Protein, His-tagged
Cat.No. : | BST1-001H |
Product Overview : | Recombinant human BST1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Description : | BST1, also known as ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2, is a glycosylphosphatidyl inositol (GPI) anchored membrane protein that belongs to the CD38 family. It was originally identified as a bone marrow stromal cell molecule. This protein is an ectoenzyme sharing several characteristics with ADP-ribosyl cyclase CD38. Along with CD38, it exhibits both DP-ribosyl cyclase and cyclinc ADP ribose hydrolase activities. It may play a role in rheumatoid arthritis (RA) due to its enhanced expression in RA-derived bone marrow stromal cell lines. Also, it is expressed by cells of the myeloid lineage and could act as a receptor with signal transduction capability. |
Form : | Liquid |
Molecular Mass : | 30.5 kDa |
N-terminal Sequence Analysis : | Arg 33 |
Endotoxin : | < 0.1 EU per 1μg of protein (determined by LAL method) |
Purity : | > 95% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | RWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAHHHHHH |
Gene Name | BST1 bone marrow stromal cell antigen 1 [ Homo sapiens (human) ] |
Official Symbol | BST1 |
Synonyms | BST1; bone marrow stromal cell antigen 1; CD157; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; ADP-ribosyl cyclase 2; NAD(+) nucleosidase; bone marrow stromal antigen 1; bone marrow stromal cell antigen 1 variant 2; cADPr hydrolase 2; cyclic ADP-ribose hydrolase 2; EC 3.2.2.6 |
Gene ID | 683 |
mRNA Refseq | NM_004334 |
Protein Refseq | NP_004325 |
MIM | 600387 |
UniProt ID | Q10588 |
◆ Recombinant Proteins | ||
BST1-5121H | Recombinant Human BST1 Protein (Met1-Lys292), C-His tagged | +Inquiry |
Bst1-7108R | Recombinant Rat Bst1 protein, His & T7-tagged | +Inquiry |
BST1-363H | Recombinant Human BST1 Protein, GST-tagged | +Inquiry |
BST1-2836H | Recombinant Human BST1 Protein, MYC/DDK-tagged | +Inquiry |
BST1-3747HF | Recombinant Full Length Human BST1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
BST1-2620MCL | Recombinant Mouse BST1 cell lysate | +Inquiry |
BST1-2801HCL | Recombinant Human BST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BST1 Products
Required fields are marked with *
My Review for All BST1 Products
Required fields are marked with *
0
Inquiry Basket