Active Recombinant Human BRSK1 Protein, GST-tagged

• Cat.No.: BRSK1-349H
• Product Overview: Human BRSK1 partial ORF ( NP_115806, 289 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Bio-activity: The activity was measured by off-chip mobility shift assay. The enzyme was incubated with fluorescence-labeled substrate and Mg(or Mn)/ATP. SubstrateThe phosphorylated and unphosphorylated substrates were separated and detected by LabChip 3000. Substrate: CHKtide. ATP: 100 uM.
• Molecular Mass: 35.86 kDa
• AA Sequence: KHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRK
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRSK1 BR serine/threonine kinase 1 [ Homo sapiens ]
• Official Symbol: BRSK1
• Synonyms: BRSK1; BR serine/threonine kinase 1; serine/threonine-protein kinase BRSK1; KIAA1811; SAD1 kinase; SAD1 homolog; protein kinase SAD1A; brain-selective kinase 1; SadB kinase short isoform; BR serine/threonine-protein kinase 1; serine/threonine-protein kinase SAD-B; synapses of Amphids Defective homolog 1; brain-specific serine/threonine-protein kinase 1; hSAD1; FLJ43009
• Gene ID: 84446
• mRNA Refseq: NM_032430
• Protein Refseq: NP_115806
• MIM: 609235
• UniProt ID: Q8TDC3