Recombinant Human BRK1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BRK1-1039H
• Product Overview: C3orf10 MS Standard C13 and N15-labeled recombinant protein (NP_060932) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: BRK1 (BRICK1 Subunit Of SCAR/WAVE Actin Nucleating Complex) is a Protein Coding gene. Diseases associated with BRK1 include Cataract 40 and Spinocerebellar Ataxia, Autosomal Recessive 3. Among its related pathways are Signaling by GPCR and G-protein signaling RAC1 in cellular process. Gene Ontology (GO) annotations related to this gene include Rac GTPase binding.
• Molecular Mass: 8.7 kDa
• AA Sequence: MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BRK1 BRICK1 subunit of SCAR/WAVE actin nucleating complex [ Homo sapiens (human) ]
• Official Symbol: BRK1
• Synonyms: BRK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit; C3orf10, chromosome 3 open reading frame 10; protein BRICK1; BRICK1; SCAR/WAVE actin nucleating complex subunit; homolog (Arabidopsis thaliana); haematopoietic stem/progenitor cell protein 300; HSPC300; MDS027; probable protein BRICK1; BRICK1, SCAR/WAVE actin-nucleating complex subunit, homolog; hHBrk1; C3orf10
• Gene ID: 55845
• mRNA Refseq: NM_018462
• Protein Refseq: NP_060932
• MIM: 611183
• UniProt ID: Q8WUW1