Recombinant Human BNIP2 Protein, GST-tagged
Cat.No. : | BNIP2-293H |
Product Overview : | Human BNIP2 full-length ORF ( AAH02461, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 60.28 kDa |
AA Sequence : | MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BNIP2 BCL2/adenovirus E1B 19kDa interacting protein 2 [ Homo sapiens ] |
Official Symbol | BNIP2 |
Synonyms | BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2; |
Gene ID | 663 |
mRNA Refseq | NM_004330 |
Protein Refseq | NP_004321 |
MIM | 603292 |
UniProt ID | Q12982 |
◆ Recombinant Proteins | ||
BNIP2-11430Z | Recombinant Zebrafish BNIP2 | +Inquiry |
BNIP2-45H | Recombinant Human BNIP2, His-tagged | +Inquiry |
BNIP2-3757HF | Recombinant Full Length Human BNIP2 Protein, GST-tagged | +Inquiry |
BNIP2-293H | Recombinant Human BNIP2 Protein, GST-tagged | +Inquiry |
BNIP2-4995H | Recombinant Human BNIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BNIP2-8424HCL | Recombinant Human BNIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BNIP2 Products
Required fields are marked with *
My Review for All BNIP2 Products
Required fields are marked with *
0
Inquiry Basket