Recombinant Human BNIP2, His-tagged

• Cat.No.: BNIP2-45H
• Product Overview: Recombinant Human BCL2/Adenovirus E1B 19 kDa Protein-Interacting Protein 3/BNIP3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Lys163) of Human BNIP3 fused with a His tag at the N-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-163 a.a.
• Description: BCL2/Adenovirus E1B 19 kDa Protein-Iinteracting Protein 3 (BNIP3) is a single-pass membrane protein. BNIP3 is a member of the NIP3 family. BNIP3 contains a single Bcl-2 homology 3 domain and interacts with the E1B 19 kDa protein. BNIP3 have been associated with pro-apoptotic function. BNIP3 is an apoptosis-inducing protein that can overcome BCL2 suppression. It plays a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. BNIP3 involved in mitochondrial quality control via its interaction with SPATA18/MIEAP, response to mitochondrial damage, participates to mitochondrial protein catabolic process.
• Form: Supplied as a 0.2 μM filtered solution of PBS, pH 7.4
• AA Sequence: MNHKVHHHHHHMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHES GRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWD WSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLLSRPAV
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Store at Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: BNIP2 BCL2/adenovirus E1B 19kDa interacting protein 2 [ Homo sapiens ]
• Official Symbol: BNIP2
• Synonyms: BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2
• Gene ID: 663
• mRNA Refseq: NM_004330
• Protein Refseq: NP_004321
• MIM: 603292
• UniProt ID: Q12982
• Chromosome Location: 15q21.3
• Pathway: CDO in myogenesis, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Myogenesis, organism-specific biosystem
• Function: GTPase activator activity; calcium ion binding; protein binding