Recombinant Full Length Human BNIP2 Protein, GST-tagged

Cat.No. : BNIP2-3757HF
Product Overview : Human BNIP2 full-length ORF ( AAH02461, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 60.28 kDa
Protein length : 314 amino acids
AA Sequence : MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BNIP2 BCL2 interacting protein 2 [ Homo sapiens (human) ]
Official Symbol BNIP2
Synonyms BNIP2; BCL2/adenovirus E1B 19kDa interacting protein 2; BCL2/adenovirus E1B 19kD interacting protein 2; BCL2/adenovirus E1B 19 kDa protein-interacting protein 2; BNIP 2; Nip2; NIP2; BNIP-2;
Gene ID 663
mRNA Refseq NM_004330
Protein Refseq NP_004321
MIM 603292
UniProt ID Q12982

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BNIP2 Products

Required fields are marked with *

My Review for All BNIP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon