Recombinant Human BIRC6 Protein, GST-tagged
Cat.No. : | BIRC6-230H |
Product Overview : | Human BIRC6 partial ORF ( NP_057336, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with a BIR (baculoviral inhibition of apoptosis protein repeat) domain and a UBCc (ubiquitin-conjugating enzyme E2, catalytic) domain. This protein inhibits apoptosis by facilitating the degradation of apoptotic proteins by ubiquitination. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RDGCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVT |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIRC6 baculoviral IAP repeat containing 6 [ Homo sapiens ] |
Official Symbol | BIRC6 |
Synonyms | BIRC6; baculoviral IAP repeat containing 6; baculoviral IAP repeat-containing protein 6; apollon; BRUCE; baculoviral IAP repeat-containing 6; ubiquitin-conjugating BIR domain enzyme apollon; ubiquitin-conjugating BIR-domain enzyme apollon; BIR repeat-containing ubiquitin-conjugating enzyme; APOLLON; FLJ13726; FLJ13786; KIAA1289; |
Gene ID | 57448 |
mRNA Refseq | NM_016252 |
Protein Refseq | NP_057336 |
MIM | 605638 |
UniProt ID | Q9NR09 |
◆ Recombinant Proteins | ||
BIRC6-1170H | Recombinant Human BIRC6 protein, His-tagged | +Inquiry |
BIRC6-230H | Recombinant Human BIRC6 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BIRC6 Products
Required fields are marked with *
My Review for All BIRC6 Products
Required fields are marked with *
0
Inquiry Basket