Recombinant Human BCR Protein, GST-tagged

• Cat.No.: BCR-177H
• Product Overview: Human BCR partial ORF ( NP_004318.3, 182 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCR breakpoint cluster region [ Homo sapiens ]
• Official Symbol: BCR
• Synonyms: BCR; breakpoint cluster region; BCR1, D22S11; breakpoint cluster region protein; ALL; CML; D22S662; PHL; renal carcinoma antigen NY-REN-26; BCR1; D22S11; FLJ16453
• Gene ID: 613
• mRNA Refseq: NM_004327
• Protein Refseq: NP_004318
• MIM: 151410
• UniProt ID: P11274