Recombinant Human BCR Protein, GST-tagged
Cat.No. : | BCR-177H |
Product Overview : | Human BCR partial ORF ( NP_004318.3, 182 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | A reciprocal translocation between chromosomes 22 and 9 produces the Philadelphia chromosome, which is often found in patients with chronic myelogenous leukemia. The chromosome 22 breakpoint for this translocation is located within the BCR gene. The translocation produces a fusion protein which is encoded by sequence from both BCR and ABL, the gene at the chromosome 9 breakpoint. Although the BCR-ABL fusion protein has been extensively studied, the function of the normal BCR gene product is not clear. The protein has serine/threonine kinase activity and is a GTPase-activating protein for p21rac. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQ |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCR breakpoint cluster region [ Homo sapiens ] |
Official Symbol | BCR |
Synonyms | BCR; breakpoint cluster region; BCR1, D22S11; breakpoint cluster region protein; ALL; CML; D22S662; PHL; renal carcinoma antigen NY-REN-26; BCR1; D22S11; FLJ16453; |
Gene ID | 613 |
mRNA Refseq | NM_004327 |
Protein Refseq | NP_004318 |
MIM | 151410 |
UniProt ID | P11274 |
◆ Recombinant Proteins | ||
BCR-1436H | Recombinant Human Breakpoint Cluster Region,GST-tagged | +Inquiry |
BCR-558H | Recombinant Human BCR Protein, His-tagged | +Inquiry |
Bcr-463M | Recombinant Mouse Bcr Protein, MYC/DDK-tagged | +Inquiry |
BCR-25H | Active Recombinant Human BCR/RET protein, GST-tagged | +Inquiry |
BCR-2637H | Recombinant Human BCR protein(161-260 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCR-166HCL | Recombinant Human BCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCR Products
Required fields are marked with *
My Review for All BCR Products
Required fields are marked with *
0
Inquiry Basket