Recombinant Human BCR protein(161-260 aa), C-His-tagged
Cat.No. : | BCR-2637H |
Product Overview : | Recombinant Human BCR protein(P11274)(161-260 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Protein length : | 161-260 aa |
Form : | 0.15 M Phosphate buffered saline |
AASequence : | IRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNL |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BCR breakpoint cluster region [ Homo sapiens ] |
Official Symbol | BCR |
Synonyms | BCR; breakpoint cluster region; BCR1, D22S11; breakpoint cluster region protein; ALL; CML; D22S662; PHL; renal carcinoma antigen NY-REN-26; BCR1; D22S11; FLJ16453; |
Gene ID | 613 |
mRNA Refseq | NM_004327 |
Protein Refseq | NP_004318 |
MIM | 151410 |
UniProt ID | P11274 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BCR Products
Required fields are marked with *
My Review for All BCR Products
Required fields are marked with *
0
Inquiry Basket