Recombinant Human BCR protein(161-260 aa), C-His-tagged

• Cat.No.: BCR-2637H
• Product Overview: Recombinant Human BCR protein(P11274)(161-260 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 161-260 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: IRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNL

Gene Information

• Gene Name: BCR breakpoint cluster region [ Homo sapiens ]
• Official Symbol: BCR
• Synonyms: BCR; breakpoint cluster region; BCR1, D22S11; breakpoint cluster region protein; ALL; CML; D22S662; PHL; renal carcinoma antigen NY-REN-26; BCR1; D22S11; FLJ16453
• Gene ID: 613
• mRNA Refseq: NM_004327
• Protein Refseq: NP_004318
• MIM: 151410
• UniProt ID: P11274