Recombinant Human BCL2L2 Protein, GST-tagged

• Cat.No.: BCL2L2-156H
• Product Overview: Human BCL2L2 full-length ORF ( NP_004041.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 46.86 kDa
• AA Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCL2L2 BCL2-like 2 [ Homo sapiens ]
• Official Symbol: BCL2L2
• Synonyms: BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2
• Gene ID: 599
• mRNA Refseq: NM_001199839
• Protein Refseq: NP_001186768
• MIM: 601931
• UniProt ID: Q92843