Recombinant Human BCL2L2 Protein, GST-tagged
Cat.No. : | BCL2L2-156H |
Product Overview : | Human BCL2L2 full-length ORF ( NP_004041.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. [provided by RefSeq |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 46.86 kDa |
AA Sequence : | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCL2L2 BCL2-like 2 [ Homo sapiens ] |
Official Symbol | BCL2L2 |
Synonyms | BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2; |
Gene ID | 599 |
mRNA Refseq | NM_001199839 |
Protein Refseq | NP_001186768 |
MIM | 601931 |
UniProt ID | Q92843 |
◆ Recombinant Proteins | ||
BCL2L2-1835H | Recombinant Human BCL2-Like 2, His-tagged | +Inquiry |
BCL2L2-0373H | Recombinant Human BCL2L2 Protein (Ala2-Thr172), C-His-tagged | +Inquiry |
BCL2L2-1588H | Recombinant Human BCL2L2 protein | +Inquiry |
BCL2L2-10183H | Recombinant Human BCL2L2, His-tagged | +Inquiry |
BCL2L2-1821HFL | Recombinant Full Length Human BCL2L2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L2-8482HCL | Recombinant Human BCL2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L2 Products
Required fields are marked with *
My Review for All BCL2L2 Products
Required fields are marked with *
0
Inquiry Basket