Recombinant Full Length Human BCL2L2 Protein, C-Flag-tagged
Cat.No. : | BCL2L2-1821HFL |
Product Overview : | Recombinant Full Length Human BCL2L2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHV TPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHS SGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | BCL2L2 BCL2 like 2 [ Homo sapiens (human) ] |
Official Symbol | BCL2L2 |
Synonyms | BCLW; BCL-W; PPP1R51; BCL2-L-2 |
Gene ID | 599 |
mRNA Refseq | NM_004050.5 |
Protein Refseq | NP_004041.2 |
MIM | 601931 |
UniProt ID | Q92843 |
◆ Recombinant Proteins | ||
BCL2L2-3806H | Recombinant Human BCL2L2, His tagged | +Inquiry |
BCL2L2-26736TH | Recombinant Human BCL2L2, His-tagged | +Inquiry |
BCL2L2-5179H | Recombinant Human BCL2L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCL2L2-2349M | Recombinant Mouse BCL2L2 Protein | +Inquiry |
BCL2L2-863H | Recombinant Human BCL2L2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L2-8482HCL | Recombinant Human BCL2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L2 Products
Required fields are marked with *
My Review for All BCL2L2 Products
Required fields are marked with *
0
Inquiry Basket