Recombinant Human BCL2L2 protein
Cat.No. : | BCL2L2-1588H |
Product Overview : | Recombinant Human BCL2L2 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 171 |
Description : | This gene encodes a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators. Expression of this gene in cells has been shown to contribute to reduced cell apoptosis under cytotoxic conditions. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream PABPN1 (poly(A) binding protein, nuclear 1) gene. |
Form : | 0.2μm Filtered concentrated solution in 25 mM Hepes, pH 7.4, 100 mM KCl, 10 % Glycerol, 5 % Trehalose, 0.02 % Tween-80. |
Molecular Mass : | Approximately 18.6 kDa, a single non-glycosylated polypeptide chain containing 171 amino acids. |
AA Sequence : | ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT |
Endotoxin : | Less than 1 EU/µg of rHuBcl-w as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | BCL2L2 |
Official Symbol | BCL2L2 |
Synonyms | BCL2L2; BCL2-like 2; bcl-2-like protein 2; BCL W; KIAA0271; PPP1R51; protein phosphatase 1; regulatory subunit 51; apoptosis regulator BCL-W; protein phosphatase 1, regulatory subunit 51; BCLW; BCL-W; BCL2-L-2; |
Gene ID | 599 |
mRNA Refseq | NM_001199839 |
Protein Refseq | NP_001186768 |
MIM | 601931 |
UniProt ID | Q92843 |
◆ Recombinant Proteins | ||
BCL2L2-440H | Recombinant Human BCL2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BCL2L2-863H | Recombinant Human BCL2L2 Protein | +Inquiry |
BCL2L2-5179H | Recombinant Human BCL2L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BCL2L2-26736TH | Recombinant Human BCL2L2, His-tagged | +Inquiry |
BCL2L2-2349M | Recombinant Mouse BCL2L2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L2-8482HCL | Recombinant Human BCL2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCL2L2 Products
Required fields are marked with *
My Review for All BCL2L2 Products
Required fields are marked with *
0
Inquiry Basket