Recombinant Human BBS7 Protein, GST-tagged
Cat.No. : | BBS7-111H |
Product Overview : | Human BBS7 partial ORF ( NP_060660, 574 a.a. - 672 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 7. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG |
Purity : | Glutathione Sepharose 4 Fast Flow |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BBS7 Bardet-Biedl syndrome 7 [ Homo sapiens ] |
Official Symbol | BBS7 |
Synonyms | BBS7; Bardet-Biedl syndrome 7; Bardet-Biedl syndrome 7 protein; BBS2L1; FLJ10715; BBS2-like 1; BBS2-like protein 1; |
Gene ID | 55212 |
mRNA Refseq | NM_018190 |
Protein Refseq | NP_060660 |
MIM | 607590 |
UniProt ID | Q8IWZ6 |
◆ Recombinant Proteins | ||
BBS7-1591HF | Recombinant Full Length Human BBS7 Protein, GST-tagged | +Inquiry |
Bbs7-1829M | Recombinant Mouse Bbs7 Protein, Myc/DDK-tagged | +Inquiry |
BBS7-2314M | Recombinant Mouse BBS7 Protein | +Inquiry |
BBS7-4606Z | Recombinant Zebrafish BBS7 | +Inquiry |
BBS7-110H | Recombinant Human BBS7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BBS7-158HCL | Recombinant Human BBS7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BBS7 Products
Required fields are marked with *
My Review for All BBS7 Products
Required fields are marked with *
0
Inquiry Basket