Recombinant Human BBS7 Protein, GST-tagged

Cat.No. : BBS7-111H
Product Overview : Human BBS7 partial ORF ( NP_060660, 574 a.a. - 672 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 7. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. Two transcript variants encoding distinct isoforms have been identified for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : SILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYG
Purity : Glutathione Sepharose 4 Fast Flow
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BBS7 Bardet-Biedl syndrome 7 [ Homo sapiens ]
Official Symbol BBS7
Synonyms BBS7; Bardet-Biedl syndrome 7; Bardet-Biedl syndrome 7 protein; BBS2L1; FLJ10715; BBS2-like 1; BBS2-like protein 1;
Gene ID 55212
mRNA Refseq NM_018190
Protein Refseq NP_060660
MIM 607590
UniProt ID Q8IWZ6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BBS7 Products

Required fields are marked with *

My Review for All BBS7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon