Recombinant Human BATF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BATF3-2261H
• Product Overview: BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.5 kDa
• AA Sequence: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ]
• Official Symbol: BATF3
• Synonyms: BATF3; basic leucine zipper transcription factor, ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; JDP1; Jun dimerization protein 1; JUNDM1; SNFT; B-ATF-3; Jun dimerization protein p21SNFT; 21-kD small nuclear factor isolated from T cells; 21 kDa small nuclear factor isolated from T-cells; FLJ36352; FLJ37535
• Gene ID: 55509
• mRNA Refseq: NM_018664
• Protein Refseq: NP_061134
• MIM: 612470
• UniProt ID: Q9NR55