Recombinant Human BATF3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | BATF3-2261H |
Product Overview : | BATF3 MS Standard C13 and N15-labeled recombinant protein (NP_061134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the basic leucine zipper protein family. The encoded protein functions as a transcriptional repressor when heterodimerizing with JUN. The protein may play a role in repression of interleukin-2 and matrix metalloproteinase-1 transcription. |
Molecular Mass : | 14.5 kDa |
AA Sequence : | MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | BATF3 basic leucine zipper ATF-like transcription factor 3 [ Homo sapiens (human) ] |
Official Symbol | BATF3 |
Synonyms | BATF3; basic leucine zipper transcription factor, ATF-like 3; basic leucine zipper transcriptional factor ATF-like 3; JDP1; Jun dimerization protein 1; JUNDM1; SNFT; B-ATF-3; Jun dimerization protein p21SNFT; 21-kD small nuclear factor isolated from T cells; 21 kDa small nuclear factor isolated from T-cells; FLJ36352; FLJ37535; |
Gene ID | 55509 |
mRNA Refseq | NM_018664 |
Protein Refseq | NP_061134 |
MIM | 612470 |
UniProt ID | Q9NR55 |
◆ Recombinant Proteins | ||
BATF3-5069H | Recombinant Human BATF3, His-tagged | +Inquiry |
BATF3-468H | Recombinant Human basic leucine zipper transcription factor, ATF-like 3, His-tagged | +Inquiry |
BATF3-1293HFL | Recombinant Full Length Human BATF3 Protein, C-Flag-tagged | +Inquiry |
BATF3-945R | Recombinant Rat BATF3 Protein | +Inquiry |
BATF3-4359Z | Recombinant Zebrafish BATF3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF3-1656HCL | Recombinant Human BATF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BATF3 Products
Required fields are marked with *
My Review for All BATF3 Products
Required fields are marked with *
0
Inquiry Basket