Recombinant Rat BATF3 Protein (1-133 aa), His-tagged

Cat.No. : BATF3-1339R
Product Overview : Recombinant Rat BATF3 Protein (1-133 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens.
Source : Yeast
Species : Rat
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 17.1 kDa
Protein length : 1-133 aa
AA Sequence : MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name Batf3 basic leucine zipper transcription factor, ATF-like 3 [ Rattus norvegicus ]
Official Symbol BATF3
Synonyms BATF3; JDP-1; B-ATF-3; Jdp1;
Gene ID 60462
mRNA Refseq NM_021865
Protein Refseq NP_068637
UniProt ID P97876

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BATF3 Products

Required fields are marked with *

My Review for All BATF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon