Recombinant Rat BATF3 Protein (1-133 aa), His-tagged

• Cat.No.: BATF3-351R
• Product Overview: Recombinant Rat BATF3 Protein (1-133 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Description: AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens.
• Source: E. coli
• Species: Rat
• Tag: His
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 19.1 kDa
• Protein length: 1-133 aa
• AA Sequence: MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDAPDHPSFIWLGTLV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Batf3 basic leucine zipper transcription factor, ATF-like 3 [ Rattus norvegicus ]
• Official Symbol: BATF3
• Synonyms: BATF3; JDP-1; B-ATF-3; Jdp1
• Gene ID: 60462
• mRNA Refseq: NM_021865
• Protein Refseq: NP_068637
• UniProt ID: P97876