Recombinant Human BATF Protein, GST-tagged

• Cat.No.: BATF-093H
• Product Overview: Human BATF partial ORF ( NP_006390, 34 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.86 kDa
• AA Sequence: EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
• Purity: Glutathione Sepharose 4 Fast Flow
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BATF basic leucine zipper transcription factor, ATF-like [ Homo sapiens ]
• Official Symbol: BATF
• Synonyms: BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2
• Gene ID: 10538
• mRNA Refseq: NM_006399
• Protein Refseq: NP_006390
• MIM: 612476
• UniProt ID: Q16520