Recombinant Human BATF Protein, GST-tagged
Cat.No. : | BATF-092H |
Product Overview : | Human BATF full-length ORF ( NP_006390.1, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1/ATF transcriptional events. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 40.5 kDa |
AA Sequence : | MPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BATF basic leucine zipper transcription factor, ATF-like [ Homo sapiens ] |
Official Symbol | BATF |
Synonyms | BATF; basic leucine zipper transcription factor, ATF-like; basic leucine zipper transcriptional factor ATF-like; activating transcription factor B; B ATF; BATF1; SF HT activated gene 2; SFA 2; SF-HT-activated gene 2 protein; B-cell-activating transcription factor; SFA2; B-ATF; SFA-2; |
Gene ID | 10538 |
mRNA Refseq | NM_006399 |
Protein Refseq | NP_006390 |
MIM | 612476 |
UniProt ID | Q16520 |
◆ Recombinant Proteins | ||
BATF-2297M | Recombinant Mouse BATF Protein | +Inquiry |
BATF-602R | Recombinant Rat BATF Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF-26167TH | Recombinant Human BATF, His-tagged | +Inquiry |
BATF-424H | Recombinant Human BATF Protein, His (Fc)-Avi-tagged | +Inquiry |
BATF-1576HF | Recombinant Full Length Human BATF Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BATF-155HCL | Recombinant Human BATF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BATF Products
Required fields are marked with *
My Review for All BATF Products
Required fields are marked with *
0
Inquiry Basket