Recombinant Human B4GALT4, His-tagged

• Cat.No.: B4GALT4-27423TH
• Product Overview: Recombinant fragment, corresponding to amino acids 25-344 of Human B4GALT4 with a N terminal His tag; predicted MWt 38 kDa:

Specification

• Description: This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:reconstitution with 73 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLT NEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQ AENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYL LEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLE ALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVG RNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGW GGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYI NITVDFWFGA
• Protein length: 25-344 a.a.

Gene Information

• Gene Name: B4GALT4 UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 [ Homo sapiens ]
• Official Symbol: B4GALT4
• Synonyms: B4GALT4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; beta-1,4-galactosyltransferase 4; beta4Gal T4
• Gene ID: 8702
• mRNA Refseq: NM_003778
• Protein Refseq: NP_003769
• MIM: 604015
• Uniprot ID: O60513
• Chromosome Location: 3q13.3
• Pathway: Asparagine N-linked glycosylation, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - keratan sulfate, conserved biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, organism-specific biosystem; Glycosphingolipid biosynthesis - lacto and neolacto series, conserved biosystem
• Function: N-acetyllactosamine synthase activity; galactosyltransferase activity; metal ion binding; transferase activity, transferring glycosyl groups