Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | B3GALT5-2221H |
Product Overview : | B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149360) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 36 kDa |
AA Sequence : | MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ] |
Official Symbol | B3GALT5 |
Synonyms | B3GALT5; beta-1,3-galactosyltransferase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.- |
Gene ID | 10317 |
mRNA Refseq | NM_033170 |
Protein Refseq | NP_149360 |
MIM | 604066 |
UniProt ID | Q9Y2C3 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All B3GALT5 Products
Required fields are marked with *
My Review for All B3GALT5 Products
Required fields are marked with *
0
Inquiry Basket