Recombinant Human B3GALT5 Protein (AA 32-310), N-6×His/GFP tagged

• Cat.No.: B3GALT5-22H
• Product Overview: Recombinant Human B3GALT5 Protein (AA 32-310) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 32-310
• Description: This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene.
• Molecular Mass: ~70 kDa
• AA Sequence: KEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ]
• Official Symbol: B3GALT5
• Synonyms: B3GALT5; beta-1,3-galactosyltransferase 5; B3T5; GLCT5; B3GalTx; B3GalT-V; beta3Gal-T5; beta-3-Gx-T5; beta-1,3-GalTase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.-
• Gene ID: 10317
• mRNA Refseq: NM_006057
• Protein Refseq: NP_006048
• MIM: 604066
• UniProt ID: Q9Y2C3