Recombinant Human B3GALT5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : B3GALT5-2474H
Product Overview : B3GALT5 MS Standard C13 and N15-labeled recombinant protein (NP_149361) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of a family of membrane-bound glycoproteins. The encoded protein may synthesize type 1 Lewis antigens, which are elevated in gastrointestinal and pancreatic cancers. Alternatively spliced transcript variants using multiple alternate promoters have been observed for this gene.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 36 kDa
AA Sequence : MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name B3GALT5 beta-1,3-galactosyltransferase 5 [ Homo sapiens (human) ]
Official Symbol B3GALT5
Synonyms B3GALT5; beta-1,3-galactosyltransferase 5; B3T5; GLCT5; B3GalTx; B3GalT-V; beta3Gal-T5; beta-3-Gx-T5; beta-1,3-GalTase 5; beta-1,3-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5; homolog of C. elegans Bt toxin resistance gene bre-5; EC 2.4.1.-
Gene ID 10317
mRNA Refseq NM_033171
Protein Refseq NP_149361
MIM 604066
UniProt ID Q9Y2C3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All B3GALT5 Products

Required fields are marked with *

My Review for All B3GALT5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon