Recombinant Human ATP6V1C2 protein, GST-tagged

• Cat.No.: ATP6V1C2-1004H
• Product Overview: Human ATP6V1C2 full-length ORF ( AAH12142.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A,three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain C subunit isoforms. [provided by RefSeq, Jul 2008]
• Molecular Mass: 70.3 kDa
• AA Sequence: MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6V1C2 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2 [ Homo sapiens ]
• Official Symbol: ATP6V1C2
• Synonyms: ATP6V1C2; ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2; ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2 , ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2; V-type proton ATPase subunit C 2; ATP6C2; VMA5; V-ATPase C2 subunit; V-ATPase subunit C 2; vacuolar proton pump subunit C 2
• Gene ID: 245973
• mRNA Refseq: NM_001039362
• Protein Refseq: NP_001034451
• UniProt ID: Q8NEY4