Recombinant Human ATP6V0D1 protein, GST-tagged

• Cat.No.: ATP6V0D1-1868H
• Product Overview: Recombinant Human ATP6V0D1 protein(1-351 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-351 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ATP6V0D1 ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [ Homo sapiens ]
• Official Symbol: ATP6V0D1
• Synonyms: ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; ATP6D, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1 , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D1; V-type proton ATPase subunit d 1; ATP6DV; P39; VATX; Vma6; VPATPD; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; VMA6; ATP6D; FLJ43534
• Gene ID: 9114
• mRNA Refseq: NM_004691
• Protein Refseq: NP_004682
• MIM: 607028
• UniProt ID: P61421