Recombinant Human ATP6V0D1 protein, GST-tagged

• Cat.No.: ATP6V0D1-997H
• Product Overview: Human ATP6V0D1 full-length ORF ( AAH08861, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.35 kDa
• AA Sequence: MSFFPEHYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATP6V0D1 ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [ Homo sapiens ]
• Official Symbol: ATP6V0D1
• Synonyms: ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; ATP6D, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1 , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D1; V-type proton ATPase subunit d 1; ATP6DV; P39; VATX; Vma6; VPATPD; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; VMA6; ATP6D; FLJ43534
• Gene ID: 9114
• mRNA Refseq: NM_004691
• Protein Refseq: NP_004682
• MIM: 607028
• UniProt ID: P61421