Recombinant Human ATP4B protein, N/A-tagged

• Cat.No.: ATP4B-2566H
• Product Overview: Recombinant Human ATP4B protein(P51164)(58-291aa) was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.6 kDa
• Protein length: 58-291aa
• AA Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
• Official Symbol: ATP4B
• Synonyms: ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; proton pump beta chain; gastric H+/K+ ATPase beta subunit; gastric H(+)/K(+) ATPase subunit beta; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; ATPase, H+/K+ transporting, beta polypeptide
• Gene ID: 496
• mRNA Refseq: NM_000705
• Protein Refseq: NP_000696
• MIM: 137217
• UniProt ID: P51164