Recombinant Human ATP4B protein, N/A-tagged

Cat.No. : ATP4B-2566H
Product Overview : Recombinant Human ATP4B protein(P51164)(58-291aa) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 58-291aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.6 kDa
AA Sequence : CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
Official Symbol ATP4B
Synonyms ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; proton pump beta chain; gastric H+/K+ ATPase beta subunit; gastric H(+)/K(+) ATPase subunit beta; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; ATPase, H+/K+ transporting, beta polypeptide;
Gene ID 496
mRNA Refseq NM_000705
Protein Refseq NP_000696
MIM 137217
UniProt ID P51164

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATP4B Products

Required fields are marked with *

My Review for All ATP4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon