Recombinant Human ATP4B protein, GST-tagged

• Cat.No.: ATP4B-2943H
• Product Overview: Recombinant Human ATP4B(1 a.a. - 291 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 57.75 kDa
• AA Sequence: MAALQEKKTCGQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCLYVLMQTVDPYTPDYQD QLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKF SCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTF SLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-291 a.a.

Gene Information

• Gene Name: ATP4B ATPase, H+/K+ exchanging, beta polypeptide [ Homo sapiens ]
• Official Symbol: ATP4B
• Synonyms: ATP4B; ATPase, H+/K+ exchanging, beta polypeptide; potassium-transporting ATPase subunit beta; ATP6B; proton pump beta chain; gastric H+/K+ ATPase beta subunit; gastric H(+)/K(+) ATPase subunit beta; gastric hydrogen-potassium ATPase, beta; potassium-transporting ATPase beta chain; ATPase, H+/K+ transporting, beta polypeptide
• Gene ID: 496
• mRNA Refseq: NM_000705
• Protein Refseq: NP_000696
• MIM: 137217
• UniProt ID: P51164
• Chromosome Location: 13q34
• Pathway: Collecting duct acid secretion, organism-specific biosystem; Collecting duct acid secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; Ion channel transport, organism-specific biosystem; Ion transport by P-type ATPases, organism-specific biosystem; Oxidative phosphorylation, organism-specific biosystem
• Function: hydrogen:potassium-exchanging ATPase activity; sodium:potassium-exchanging ATPase activity