Recombinant Full Length Dog Potassium-Transporting Atpase Subunit Beta(Atp4B) Protein, His-Tagged
Cat.No. : | RFL-2592CF |
Product Overview : | Recombinant Full Length Dog Potassium-transporting ATPase subunit beta(ATP4B) Protein (P33704) (1-290aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Dog |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-290) |
Form : | Lyophilized powder |
AA Sequence : | MAALQEKKSCSQRMEEFQRYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGIFALCIYTLMCTLDPYTPDYQDQLKSPGVTLRPDVYGEKGLDISYNVSDNRTWVDLVNILHNFLEGYSPTSQEDNINCTSEKYFFQDVFGAPNHTKFSCKFMADMLQNCSGLTDPNFGFAEGKPCFIIKMNRIVNFLPSNSTAPRADCTFLDQHKDDRPLQVEYYPPNGTFSLRYFPYYGKKAQPHYSNPLVAAKLLNVPRNTEVLIVCKILADYVTFDNPHDPYEGKVEFKLTIQQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATP4B |
Synonyms | ATP4B; Potassium-transporting ATPase subunit beta; Gastric H(+/K(+ ATPase subunit beta; Proton pump beta chain |
UniProt ID | P33704 |
◆ Recombinant Proteins | ||
ATP4B-2943H | Recombinant Human ATP4B protein, GST-tagged | +Inquiry |
ATP4B-1337H | Recombinant Human ATP4B Protein (58-291 aa), His-tagged | +Inquiry |
ATP4B-2435H | Recombinant Human ATP4B protein, GST-tagged | +Inquiry |
ATP4B-2566H | Recombinant Human ATP4B protein, N/A-tagged | +Inquiry |
ATP4B-5988C | Recombinant Chicken ATP4B | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP4B-8607HCL | Recombinant Human ATP4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP4B Products
Required fields are marked with *
My Review for All ATP4B Products
Required fields are marked with *
0
Inquiry Basket