Recombinant Human ATG10 protein, GST-tagged

• Cat.No.: ATG10-942H
• Product Overview: Human ATG10 full-length ORF ( NP_113670.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 51.7 kDa
• AA Sequence: MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG10 ATG10 autophagy related 10 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG10
• Synonyms: ATG10; ATG10 autophagy related 10 homolog (S. cerevisiae); APG10 autophagy 10 like (S. cerevisiae) , APG10L; ubiquitin-like-conjugating enzyme ATG10; DKFZP586I0418; FLJ13954; autophagy-related protein 10; APG10; APG10L; pp12616; DKFZp586I0418
• Gene ID: 83734
• mRNA Refseq: NM_001131028
• Protein Refseq: NP_001124500
• MIM: 610800
• UniProt ID: Q9H0Y0