Recombinant Human ARHGEF7 protein, GST-tagged

• Cat.No.: ARHGEF7-790H
• Product Overview: Human ARHGEF7 partial ORF ( NP_663788, 102 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. Multiple alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Mar 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.53 kDa
• AA Sequence: SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGEF7 Rho guanine nucleotide exchange factor (GEF) 7 [ Homo sapiens ]
• Official Symbol: ARHGEF7
• Synonyms: ARHGEF7; Rho guanine nucleotide exchange factor (GEF) 7; rho guanine nucleotide exchange factor 7; BETA PIX; COOL1; DKFZp686C12170; DKFZp761K1021; guanine nucleotide exchange factor 7; KIAA0142; Nbla10314; P50; P50BP; P85; P85COOL1; P85SPR; PAK interacting exchange factor beta; PAK3; PIXB; rho; SH3 domain containing proline rich protein; PAK-interacting exchange factor beta; SH3 domain-containing proline-rich protein; COOL-1; BETA-PIX
• Gene ID: 8874
• mRNA Refseq: NM_001113511
• Protein Refseq: NP_001106983
• MIM: 605477
• UniProt ID: Q14155