Recombinant Human ARHGAP4 protein, GST-tagged
Cat.No. : | ARHGAP4-770H |
Product Overview : | Human ARHGAP4 partial ORF ( AAH52303, 881 a.a. - 986 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ] |
Official Symbol | ARHGAP4 |
Synonyms | ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4; Rho-GAP hematopoietic protein C1; rho-type GTPase-activating protein 4; RGC1; |
Gene ID | 393 |
mRNA Refseq | NM_001164741 |
Protein Refseq | NP_001158213 |
MIM | 300023 |
UniProt ID | P98171 |
◆ Recombinant Proteins | ||
ARHGAP4-9827H | Recombinant Human ARHGAP4, GST-tagged | +Inquiry |
ARHGAP4-26278TH | Recombinant Human ARHGAP4, His-tagged | +Inquiry |
ARHGAP4-770H | Recombinant Human ARHGAP4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGAP4-113HCL | Recombinant Human ARHGAP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP4 Products
Required fields are marked with *
My Review for All ARHGAP4 Products
Required fields are marked with *
0
Inquiry Basket