Recombinant Human ARHGAP4 protein, GST-tagged

Cat.No. : ARHGAP4-770H
Product Overview : Human ARHGAP4 partial ORF ( AAH52303, 881 a.a. - 986 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins belonging to the RAS superfamily. The protein encoded by the orthologous gene in rat is localized to the Golgi complex and can redistribute to microtubules. The rat protein stimulates the activity of some Rho GTPases in vitro. Genomic deletions of this gene and a neighboring gene have been found in patients with nephrogenic diabetes insipidus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
Molecular Mass : 37.29 kDa
AA Sequence : TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGAP4 Rho GTPase activating protein 4 [ Homo sapiens ]
Official Symbol ARHGAP4
Synonyms ARHGAP4; Rho GTPase activating protein 4; rho GTPase-activating protein 4; C1; KIAA0131; p115; Rho GAP hematopoietic protein C1; RhoGAP4; SrGAP4; Rho-GAP hematopoietic protein C1; rho-type GTPase-activating protein 4; RGC1;
Gene ID 393
mRNA Refseq NM_001164741
Protein Refseq NP_001158213
MIM 300023
UniProt ID P98171

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARHGAP4 Products

Required fields are marked with *

My Review for All ARHGAP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon