Recombinant Human APOC3 protein, GST-tagged

• Cat.No.: APOC3-706H
• Product Overview: Human APOC3 full-length ORF (AAH27977.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.29 kDa
• AA Sequence: MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOC3 apolipoprotein C-III [ Homo sapiens ]
• Official Symbol: APOC3
• Synonyms: APOC3; apolipoprotein C-III; apo-CIII; apoC-III; apolipoprotein C3; HALP2; APOCIII; MGC150353
• Gene ID: 345
• mRNA Refseq: NM_000040
• Protein Refseq: NP_000031
• MIM: 107720
• UniProt ID: P02656