Recombinant Cynomolgus Monkey APOC3 Protein (21-99 aa), His-SUMOSTAR-tagged

• Cat.No.: APOC3-2235C
• Product Overview: Recombinant Cynomolgus Monkey (Macaca fascicularis) (Crab-eating macaque) APOC3 Protein (21-99 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-SUMOSTAR tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Cynomolgus
• Source: Yeast
• Tag: His&SUMO
• Protein Length: 21-99 aa
• Description: Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.7 kDa
• AA Sequence: SEAEDTSLLGFMQGYMQHATKTAKDALTSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKLSGFWDLNPEAKPTLAEAA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: APOC3 apolipoprotein C3 [ Macaca fascicularis (crab-eating macaque) ]
• Official Symbol: APOC3
• Synonyms: APOC3; apoCIII; Apo-CIII; ApoC-III
• Gene ID: 102144085
• mRNA Refseq: XM_005579730
• Protein Refseq: XP_005579787
• UniProt ID: P18659