Recombinant Human APG7L protein, GST-tagged

• Cat.No.: APG7L-680H
• Product Overview: Human APG7L partial ORF ( NP_006386, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG7 ATG7 autophagy related 7 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ATG7
• Synonyms: ATG7; ATG7 autophagy related 7 homolog (S. cerevisiae); APG7 autophagy 7 like (S. cerevisiae) , APG7L; ubiquitin-like modifier-activating enzyme ATG7; DKFZp434N0735; GSA7; hAGP7; autophagy-related protein 7; ATG12-activating enzyme E1 ATG7; ubiquitin activating enzyme E1-like protein; ubiquitin-activating enzyme E1-like protein; APG7L; APG7-LIKE
• Gene ID: 10533
• mRNA Refseq: NM_001136031
• Protein Refseq: NP_001129503
• MIM: 608760
• UniProt ID: O95352