Recombinant Human APEX1, T7 -tagged

• Cat.No.: APEX1-27360TH
• Product Overview: Recombinant full length Human APE1 with an N terminal T7 tag; 332 amino acids with tag, Predicted MWt 36.9 kDa.

Specification

• Description: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5 to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
• Protein length: 318 amino acids
• Conjugation: T7
• Molecular Weight: 36.900kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
• Sequence Similarities: Belongs to the DNA repair enzymes AP/ExoA family.

Gene Information

• Gene Name: APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
• Official Symbol: APEX1
• Synonyms: APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1
• Gene ID: 328
• mRNA Refseq: NM_001244249
• Protein Refseq: NP_001231178
• MIM: 107748
• Uniprot ID: P27695
• Chromosome Location: 14q11.2
• Pathway: BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem
• Function: 3-5 exonuclease activity; 3-5 exonuclease activity; DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA-(apurinic or apyrimidinic site) lyase activity