Recombinant Human APEX1, T7 -tagged

Cat.No. : APEX1-27360TH
Product Overview : Recombinant full length Human APE1 with an N terminal T7 tag; 332 amino acids with tag, Predicted MWt 36.9 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 318 amino acids
Description : Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5 to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.
Conjugation : T7
Molecular Weight : 36.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Sequence Similarities : Belongs to the DNA repair enzymes AP/ExoA family.
Gene Name APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
Official Symbol APEX1
Synonyms APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1;
Gene ID 328
mRNA Refseq NM_001244249
Protein Refseq NP_001231178
MIM 107748
Uniprot ID P27695
Chromosome Location 14q11.2
Pathway BER complex, organism-specific biosystem; BER complex, conserved biosystem; Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem;
Function 3-5 exonuclease activity; 3-5 exonuclease activity; DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA-(apurinic or apyrimidinic site) lyase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All APEX1 Products

Required fields are marked with *

My Review for All APEX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon