Recombinant Human APEX1 protein(11-90 aa), C-His-tagged

• Cat.No.: APEX1-2705H
• Product Overview: Recombinant Human APEX1 protein(P27695)(11-90 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 11-90 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: AEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPD
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
• Official Symbol: APEX1
• Synonyms: APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX
• Gene ID: 328
• mRNA Refseq: NM_001244249
• Protein Refseq: NP_001231178
• MIM: 107748
• UniProt ID: P27695