Recombinant Human APEX1 protein, His-tagged

• Cat.No.: APEX1-2528H
• Product Overview: Recombinant Human APEX1 protein(P27695)(32-318aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.2 kDa
• Protein length: 32-318aa
• AA Sequence: KNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: APEX1 APEX nuclease (multifunctional DNA repair enzyme) 1 [ Homo sapiens ]
• Official Symbol: APEX1
• Synonyms: APEX1; APEX nuclease (multifunctional DNA repair enzyme) 1; APEX, APEX nuclease (multifunctional DNA repair enzyme); DNA-(apurinic or apyrimidinic site) lyase; APE; APE 1; APEN; APX; HAP1; REF 1; REF1; AP lyase; protein REF-1; redox factor-1; AP endonuclease class I; apurinic-apyrimidinic endonuclease 1; apurinic/apyrimidinic (abasic) endonuclease; deoxyribonuclease (apurinic or apyrimidinic); APE1; APEX
• Gene ID: 328
• mRNA Refseq: NM_001244249
• Protein Refseq: NP_001231178
• MIM: 107748
• UniProt ID: P27695