Recombinant Human ANXA2 protein

Cat.No. : ANXA2-1846H
Product Overview : Recombinant Human ANXA2(Ser2-Asp339) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : Ser2-Asp339
Form : Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, 1mM EDTA, pH 7.5
AA Sequence : MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSN AQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIE IICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA RDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLV QCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKG DYQKALLYLCGGDD
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Gene Name ANXA2 annexin A2 [ Homo sapiens ]
Official Symbol ANXA2
Synonyms ANXA2; annexin A2; ANX2, ANX2L4, CAL1H, LPC2D; annexin II; LIP2; annexin-2; protein I; lipocortin II; chromobindin 8; chromobindin-8; calpactin I heavy chain; calpactin-1 heavy chain; calpactin I heavy polypeptide; placental anticoagulant protein IV; P36; ANX2; LPC2; CAL1H; LPC2D; ANX2L4; PAP-IV;
Gene ID 302
mRNA Refseq NM_001002857
Protein Refseq NP_001002857
MIM 151740
UniProt ID P07355
Chromosome Location 15q22.2
Pathway Prostaglandin Synthesis and Regulation, organism-specific biosystem;
Function Rab GTPase binding; calcium ion binding; calcium-dependent phospholipid binding; cytoskeletal protein binding; phosphatidylinositol-4,5-bisphosphate binding; phospholipase inhibitor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANXA2 Products

Required fields are marked with *

My Review for All ANXA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon