Recombinant Human AMY1A protein, GST-tagged

• Cat.No.: AMY1A-533H
• Product Overview: Human AMY1A partial ORF ( NP_001008222, 172 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
• Molecular Mass: 33.88 kDa
• AA Sequence: VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMY1A amylase, alpha 1A (salivary) [ Homo sapiens ]
• Official Symbol: AMY1A
• Synonyms: AMY1A; amylase, alpha 1A (salivary); AMY1, amylase, alpha 1A; salivary; alpha-amylase 1; glycogenase; salivary alpha-amylase; salivary amylase alpha 1A; amylase, salivary, alpha-1A; 1,4-alpha-D-glucan glucanohydrolase 1; AMY1; AMY1B; AMY1C
• Gene ID: 276
• mRNA Refseq: NM_001008221
• Protein Refseq: NP_001008222
• MIM: 104700
• UniProt ID: P04745