Recombinant Full Length Human AMY1A Protein, C-Flag-tagged
Cat.No. : | AMY1A-726HFL |
Product Overview : | Recombinant Full Length Human AMY1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Amylases are secreted proteins that hydrolyze 1,4-alpha-glucoside bonds in oligosaccharides and polysaccharides, and thus catalyze the first step in digestion of dietary starch and glycogen. The human genome has a cluster of several amylase genes that are expressed at high levels in either salivary gland or pancreas. This gene encodes an amylase isoenzyme produced by the salivary gland. Alternative splicing results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.9 kDa |
AA Sequence : | MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRD FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFR IDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF TRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA HFSISNSAEDPFIAIHAESKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways : | Metabolic pathways, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | AMY1A amylase alpha 1A [ Homo sapiens (human) ] |
Official Symbol | AMY1A |
Synonyms | AMY1 |
Gene ID | 276 |
mRNA Refseq | NM_004038.4 |
Protein Refseq | NP_004029.2 |
MIM | 104700 |
UniProt ID | Q6NSB3 |
◆ Recombinant Proteins | ||
AMY1A-1118C | Recombinant Chicken AMY1A | +Inquiry |
AMY1A-336H | Recombinant Human AMY1A Protein, His (Fc)-Avi-tagged | +Inquiry |
AMY1A-0538H | Recombinant Human AMY1A Protein (Ala15-Leu511), His-tagged | +Inquiry |
AMY1A-2967H | Recombinant Human AMY1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMY1A-726HFL | Recombinant Full Length Human AMY1A Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
AMY1A-8023H | Native Human Salivary Amylase (Alpha) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMY1A Products
Required fields are marked with *
My Review for All AMY1A Products
Required fields are marked with *
0
Inquiry Basket