Recombinant Human ALKBH1 protein, His-tagged

• Cat.No.: ALKBH1-2882H
• Product Overview: Recombinant Human ALKBH1 protein(15 - 169 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 15 - 169 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ALKBH1 alkB, alkylation repair homolog 1 (E. coli) [ Homo sapiens ]
• Official Symbol: ALKBH1
• Synonyms: ALKBH1; alkB, alkylation repair homolog 1 (E. coli); alkB, alkylation repair homolog (E. coli) , ALKBH; alkylated DNA repair protein alkB homolog 1; ABH; alkB; hABH; DNA lyase ABH1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; ABH1; ALKBH
• Gene ID: 8846
• mRNA Refseq: NM_006020
• Protein Refseq: NP_006011
• MIM: 605345
• UniProt ID: Q13686