Recombinant Human ALKBH1 Protein, GST-tagged

• Cat.No.: ALKBH1-474H
• Product Overview: Human ALKBH full-length ORF ( AAH25787.1, 1 a.a. - 389 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a homolog to the E. coli alkB gene product. The E. coli alkB protein is part of the adaptive response mechanism of DNA alkylation damage repair. It is involved in damage reversal by oxidative demethylation of 1-methyladenine and 3-methylcytosine. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 68.42 kDa
• AA Sequence: MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALKBH1 alkB, alkylation repair homolog 1 (E. coli) [ Homo sapiens ]
• Official Symbol: ALKBH1
• Synonyms: ALKBH1; alkB, alkylation repair homolog 1 (E. coli); alkB, alkylation repair homolog (E. coli) , ALKBH; alkylated DNA repair protein alkB homolog 1; ABH; alkB; hABH; DNA lyase ABH1; alkylation repair, alkB homolog; alpha-ketoglutarate-dependent dioxygenase ABH1; ABH1; ALKBH
• Gene ID: 8846
• mRNA Refseq: NM_006020
• Protein Refseq: NP_006011
• MIM: 605345
• UniProt ID: Q13686